Protein Info for H281DRAFT_03311 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 54 (54 residues), see Phobius details transmembrane" amino acids 71 to 97 (27 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details TIGR02866: cytochrome c oxidase, subunit II" amino acids 63 to 269 (207 residues), 153.9 bits, see alignment E=2e-49 PF00116: COX2" amino acids 183 to 257 (75 residues), 62.5 bits, see alignment E=5.5e-21 PF13442: Cytochrome_CBB3" amino acids 284 to 369 (86 residues), 29 bits, see alignment E=1.6e-10 PF00034: Cytochrom_C" amino acids 285 to 373 (89 residues), 58.7 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 83% identity to bug:BC1001_5388)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>H281DRAFT_03311 cytochrome c oxidase subunit 2 (Paraburkholderia bryophila 376MFSha3.1)
MRPSMKTGQASRTDLQSVAGRPPRGATAPRAAAAFAVAVAAALSGGLAFEAQAAPAHDAL
RPAGAQAAHIFSLWTVTLTVCSLVFAAVLIALLFAVARAPRVSRDASPDLGSLERPERRV
GRVVSGASIASVVLLFGLLLADIMTDRALSRLPVADAVHLEMTGHQWWWEARYADDTPGS
GFAVANELHVPVGRPVVISLKADDVIHTFWVPNLHGKKDMIPGRESTIEFRADRAGTYRG
QCAEFCGLEHALMAFTVVAEPPAQYDAWVARQRTPAPQPVDALQAQGERLFTTGNCAGCH
TVRGTSANGVIGPDLTHVMSRPMLAAETFENTPANLESWIKAPGSMKPGTTMPATQLSAQ
DLNALIAWIRTLQ