Protein Info for H281DRAFT_03279 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 5 to 352 (348 residues), 342.6 bits, see alignment E=1.9e-106 PF04851: ResIII" amino acids 13 to 175 (163 residues), 39.1 bits, see alignment E=1.5e-13 PF00270: DEAD" amino acids 16 to 182 (167 residues), 98.9 bits, see alignment E=5.5e-32 PF00271: Helicase_C" amino acids 227 to 334 (108 residues), 72.8 bits, see alignment E=5.3e-24 PF16124: RecQ_Zn_bind" amino acids 444 to 491 (48 residues), 43.6 bits, see alignment 8.2e-15

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 90% identity to bug:BC1001_5354)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>H281DRAFT_03279 ATP-dependent DNA helicase RecQ (Paraburkholderia bryophila 376MFSha3.1)
MRKTMRDMFGIVRLRAGQEDIIRSVLQHNDTLATMPTGAGKSLCYQLPALHLEGTTLVVS
PLIALMKDQADKLLAAGIDCTLVNSTLRSRAEREALERIAAGESGIVFVTPERLAQPAFI
ETLRARPENRVGLVVVDEAHCVSQWGHDFRPAFLQIAAAVKSLGQPPVLALTATATPRVL
DDIVHSLALREPRVVRTGTYRENLRYRVVQVSTAGGKDGAARAVTAKREQLSKLIASLSG
TGIVYAATVRDVDRIYGWLTEAGESVSRYHGRMAADAREEAQEQFMSGATRLMIATNAFG
MGIDKADIRFVIHYQIPGSLDAYYQETGRAGRDGEPADCVLLFDLNDRRIQQFFLAGRYP
SVELAQRVYDTLVARIADEPKGVTLGALKQALPDVGAGKLETALNMLVDARVAGRDRQRR
YRLRSREGAKESARDAVANAAAQFEQMSAHDRETLQQMIDYAQTGQCRWRAILDYYGDSP
AAERCGVCDNCVNPPQIDMASDAIVAPETHANEVAQRKREESRKPRVWTPGDAVRVPRYG
AGEVALASGEQVAVQFPDGSTRTFLASYVRAGR