Protein Info for H281DRAFT_03248 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Tetratricopeptide (TPR) repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 66 to 121 (56 residues), 18.3 bits, 2e-06
  • amino acids 94 to 153 (60 residues), 29.6 bits, 6.1e-10
  • amino acids 129 to 187 (59 residues), 34.1 bits, 2.4e-11
  • amino acids 162 to 224 (63 residues), 36.2 bits, E=5.3e-12
  • amino acids 195 to 257 (63 residues), 30 bits, E=4.5e-10
  • amino acids 270 to 324 (55 residues), 35.3 bits, 9.9e-12
  • amino acids 343 to 391 (49 residues), 31.9 bits, 1.2e-10
• PF13181: TPR_8
  • amino acids 89 to 119 (31 residues), 11.8 bits, see alignment (E = 0.00019)
  • amino acids 122 to 155 (34 residues), 15.5 bits, see alignment (E = 1.3e-05)
  • amino acids 156 to 181 (26 residues), 13.8 bits, see alignment (E = 4.4e-05)
  • amino acids 190 to 222 (33 residues), 25.9 bits, see alignment (E = 5.7e-09)
  • amino acids 258 to 290 (33 residues), 16.3 bits, see alignment (E = 7.1e-06)
  • amino acids 292 to 323 (32 residues), 26.3 bits, see alignment (E = 4.4e-09)
• PF07719: TPR_2
  • amino acids 122 to 155 (34 residues), 26.6 bits, see alignment (E = 3.4e-09)
  • amino acids 190 to 222 (33 residues), 28.2 bits, see alignment (E = 1.1e-09)
  • amino acids 292 to 324 (33 residues), 30.8 bits, see alignment (E = 1.5e-10)
  • amino acids 360 to 390 (31 residues), 24 bits, see alignment (E = 2.3e-08)
• PF07721: TPR_4
  • amino acids 124 to 147 (24 residues), 10.8 bits, see alignment (E = 0.00057)
  • amino acids 156 to 181 (26 residues), 14.6 bits, see alignment (E = 3.3e-05)
  • amino acids 190 to 215 (26 residues), 11.1 bits, see alignment (E = 0.00047)
  • amino acids 258 to 282 (25 residues), 10.3 bits, see alignment (E = 0.00086)
• PF13374: TPR_10
  • amino acids 126 to 152 (27 residues), 14.9 bits, see alignment (E = 1.8e-05)
  • amino acids 194 to 220 (27 residues), 18.7 bits, see alignment (E = 1.2e-06)
  • amino acids 263 to 288 (26 residues), 17.6 bits, see alignment (E = 2.6e-06)
  • amino acids 292 to 322 (31 residues), 17.9 bits, see alignment (E = 2e-06)
  • amino acids 365 to 390 (26 residues), 14.9 bits, see alignment (E = 1.8e-05)
• PF13414: TPR_11
  • amino acids 131 to 169 (39 residues), 31.8 bits, 7.4e-11
  • amino acids 197 to 234 (38 residues), 30.2 bits, 2.3e-10
  • amino acids 268 to 305 (38 residues), 35 bits, 7.2e-12
  • amino acids 342 to 373 (32 residues), 29.9 bits, see alignment (E = 2.9e-10)
• PF00515: TPR_1
  • amino acids 190 to 223 (34 residues), 29.5 bits, see alignment (E = 3.9e-10)
  • amino acids 292 to 323 (32 residues), 32.6 bits, see alignment (E = 3.8e-11)
• PF13424: TPR_12
  • amino acids 257 to 322 (66 residues), 34.9 bits, E=1.2e-11
  • amino acids 326 to 390 (65 residues), 37.8 bits, E=1.4e-12
• PF13174: TPR_6
  • amino acids 293 to 323 (31 residues), 12.9 bits, see alignment (E = 0.00012)

Best Hits

KEGG orthology group: None (inferred from 84% identity to bug:BC1001_4073)

Predicted SEED Role

"FOG: TPR repeat"

Protein Sequence (716 amino acids)

>H281DRAFT_03248 Tetratricopeptide (TPR) repeat (Paraburkholderia bryophila 376MFSha3.1)
MNLTQTLASSITELNQQAMALYSADQFAAALSTVMPVIERDESALDGAAIHAMADALNLA
GASSCRLGEPDDAERYWRRCLRMMPGYVEVYESLGELLKARGRLSAAKAIYRQLIVLQPG
HADAHNQLGAVLYAQGYHEDAEASYRRALVLRPDHAEAHYNHGVVLHALQRLDEAEAAYR
ETLVRLPAHAEAHNNLGNVLMDLGRVAQADAAYREALTIRPQYPEALNNLAGALKAAQRL
TEAELACRLALTMRPDYAEAHVNLGATLTDLQRLPEAEAAYRKAIALRADYAEAYYNLGI
TLFKLERLTEAAEAYREAVRLRPGIAPAHNNLGCVLRLLDCLPEAVECFEQALSVHPDLA
EAHYNLGATLAQLKRWPGAESAYRRALELRADYGEARFGLATLLLGMGRFDEGWRLYECR
YQLAGFVHRHSAQRLRCPQWQGDALSGRSLLVWQEDGLGDMLQFSRYFALLKAQGAANVA
FACAPALHRLMARVDGVDAVLDHDTAVARASAYHCWTSLLSAPLHLRTAVDTIPRPVRLS
VEPSLVERWQTVIDALPPGRRIGLVWKGNAKHHNDANRSIPSLATLAPLWSVDGVSFVSL
QKGQGEDEARNPPAGQPLLHLGSMVTDLADSAAIVGQLDLVICVDTSIAHLAASLGKPCW
VVLPEKDVDWRWMHERSDSPWYPHTLRLFRRERGEEWAVVVERVRQACVARFGVRN