Protein Info for H281DRAFT_03245 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 466 to 486 (21 residues), see Phobius details PF03929: PepSY_TM" amino acids 24 to 441 (418 residues), 255.2 bits, see alignment E=1.2e-79 PF03413: PepSY" amino acids 343 to 387 (45 residues), 18.3 bits, see alignment 2.4e-07

Best Hits

KEGG orthology group: None (inferred from 80% identity to bug:BC1001_4076)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>H281DRAFT_03245 Uncharacterized iron-regulated membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MSTTIQQNAASGTATNSSGYRTLWRWHFYAGLFVMPFLVVLAITGTLYCFQPQIEPLLYP
QLLVVESRTAPRMPADALLARAQAAMPTGSVAVTTVIPDTPERSMEFIFRLADGEKQSVY
VNPYNAEVLGTLSVENRFMQIDRMLHRKLLLGKPGELLMELAACWTLVMIGTGVALWWPL
GATRARDALVPRFTLKGRPLWKSVHAVMGIWLALGALAFVLTGLPWSGSWGKQFKALASA
ANLGAPPGSWGGLPLRSVLPVAARGDVTANTTETKAHATHAGHAGHDTQAAQDNSMPGMV
MDDLPLPQAPWAVGNAPVPASTNAGTTPPLPLGRIVSQAAALGVTSGYNIALPTSATGVY
TVSYFPADPQKERTIYINQYSGTVLKDIRYADYGAVSKAVSYGTSLHMGRYFGVANQILC
AMISLGLAMMAVTGCVMWWKRRPQRSLGAPSRERAAPPMRGWKTGLIMLGIVFPLMGATL
IVVWLGDRVLFGRASRRDRVTPYESAEG