Protein Info for H281DRAFT_03234 in Paraburkholderia bryophila 376MFSha3.1

Annotation: chemotaxis protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details PF20560: MotA_N" amino acids 6 to 81 (76 residues), 36.7 bits, see alignment E=4.1e-13 PF01618: MotA_ExbB" amino acids 103 to 215 (113 residues), 93.4 bits, see alignment E=9.3e-31

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 94% identity to bpy:Bphyt_4599)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG90 at UniProt or InterPro

Protein Sequence (254 amino acids)

>H281DRAFT_03234 chemotaxis protein MotA (Paraburkholderia bryophila 376MFSha3.1)
MDLLTIFGVVFGLTAIVAGFSLEGGNFTSLFQLEAFVIVLGGTFGAVMIQNTWARFYDGV
KQLRFAFVKARQVDRESLSVLLEWGDQAKLNGMLVFESIDANGISPFAKRGLELLANGVS
TAVLEDALQREVDAYERNHMAAARIWQQAGGYAPTFGILGAVLGLIQVTGHMLEPSQLGQ
GIAVAFVATLYGLAVANLVFLPLYGKIRAQVDSELRFRRLYLDGLLAISRKESPHTIETR
LAGDVRERSAELLG