Protein Info for H281DRAFT_03232 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 2, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 78 to 105 (28 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 272 (176 residues), 63.1 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 97% identity to bpy:Bphyt_4588)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGS9 at UniProt or InterPro

Protein Sequence (283 amino acids)

>H281DRAFT_03232 carbohydrate ABC transporter membrane protein 2, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MFPIPIDKWKPATRRVYKLTLPIALLIWLLPMIAVLVTSIRSSEELSEGNYWGWPKHFAL
FDNYREALTTSPMLHYFWNSVLITVPAVIGSIALAAMAGFALAIYRFRGNSSLFATFVAG
NFVPVQVLMIPVRDLSLQLGVFNTVSALILFHVSFQTGFCALFLRNFIKQLPFELVEAAR
IEGANEWTVFFRIVLPLIRPALAALAILVFTFVWNDYFWALCLTQGDDAAPITVGVAALK
GQWTTAWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGATKG