Protein Info for H281DRAFT_03231 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 1, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 262 to 264 (3 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 312 (192 residues), 65.4 bits, see alignment E=3e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 92% identity to bpy:Bphyt_4587)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>H281DRAFT_03231 carbohydrate ABC transporter membrane protein 1, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
LSHSVTRHTVGGPAGPGGSPLPASGSTTRIHARGRRPSPTARRQRRAAFLFLAPACVMVA
IYVIWPILSTIRLSFFNWDGMTEPTFVGLANYTELFHTQTFYTALKNNLIWLLLFLLAPP
MGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLAVILGHGVPVL
GDPRYATLGIVFAALWPQTAYCMILYLTGLTSLNAEQIEAARMEGARGWSMLWHVILPQL
RPTTFMAIVVTIIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYRIGYSAAVAVV
LFGIMLVYIVYHLRRMLRAEQ