Protein Info for H281DRAFT_03225 in Paraburkholderia bryophila 376MFSha3.1

Annotation: mannose ABC transporter membrane protein /fructose ABC transporter membrane protein /ribose ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 58 to 91 (34 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 317 (268 residues), 140.9 bits, see alignment E=2.2e-45

Best Hits

Swiss-Prot: 44% identical to FRCC_RHIML: Fructose import permease protein FrcC (frcC) from Rhizobium meliloti

KEGG orthology group: K10553, fructose transport system permease protein (inferred from 98% identity to bug:BC1001_4100)

Predicted SEED Role

"Fructose ABC transporter, permease component FrcC" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIK0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>H281DRAFT_03225 mannose ABC transporter membrane protein /fructose ABC transporter membrane protein /ribose ABC transporter membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MSTPSAPAGHPRHFSDRLPSLAEVGPLIALVLACGFFISQSSRFLSFQNLSLILQQTMVV
AVIAIGQTLIVLTGGIDLSCGMVMAFGSIIMTKFAVTLGLPPALAILCGIGASTLFGVLN
GVLITRIKLPAFIVTLGTLNIAFALTQIYSNAESVSNLPDAIMFFGNTFKLGPADVTYGT
VLTLLMYLATWFVLRDTVPGRHLYALGNNAEAARLMGLSSQKILLTVYTLAGAIYGVAAL
LSVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSISGTLLGALIVGVFRNGLTLIG
VSSVYQVLITGMLVILAVAADKLSHRRG