Protein Info for H281DRAFT_03224 in Paraburkholderia bryophila 376MFSha3.1

Annotation: mannose ABC transporter ATP-binding protein /fructose ABC transporter ATP-binding protein /ribose ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 186 (158 residues), 107.6 bits, E=4e-35

Best Hits

Swiss-Prot: 68% identical to FRCA_RHIML: Fructose import ATP-binding protein FrcA (frcA) from Rhizobium meliloti

KEGG orthology group: K10554, fructose transport system ATP-binding protein (inferred from 98% identity to bxe:Bxe_B0892)

Predicted SEED Role

"Fructose ABC transporter, ATP-binding component FrcA" in subsystem Fructose utilization

Sequence Analysis Tools

See A0A2Z5MG82 at UniProt or InterPro

Protein Sequence (265 amino acids)

>H281DRAFT_03224 mannose ABC transporter ATP-binding protein /fructose ABC transporter ATP-binding protein /ribose ABC transporter ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MSTTTSASAALPVLQARGLVKRYGNVTALDGCDFEVLPGEILAVIGDNGAGKSSLIKALS
GATVPDEGEILLDGKPVKFRSPLDARAQGIETVYQELAVAPAMSIAENLFLARELVKPGW
RGSIFKMIDKRRMLEEATAHMKDLQIGIRSMRQAVETLSGGQRQGVAVARSAAFARHVVI
LDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVFEVADRIHIQRLGRRAALVN
TKDVHMSEAVAIMTGAKEADVKAIA