Protein Info for H281DRAFT_03210 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF08448: PAS_4" amino acids 29 to 138 (110 residues), 59.2 bits, see alignment E=6.8e-20 PF12833: HTH_18" amino acids 170 to 246 (77 residues), 73.9 bits, see alignment E=1.5e-24 PF00165: HTH_AraC" amino acids 214 to 246 (33 residues), 38.6 bits, see alignment 1.3e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_4115)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGQ3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>H281DRAFT_03210 transcriptional regulator, AraC family (Paraburkholderia bryophila 376MFSha3.1)
MNTLAHQFSPDEATLSGMLSHFRQLEPVFDALPDVVFFVKDADARYALVNRTLASRCGFK
EKTALLGKTAEDVFPRRFGRIYTAQDEGVIHVGNQMIDQLELHLYPGRQPGWCLTTKQPL
RDATGVIVGLAGISRDLRADESSHPAYSRLAAVVQFIQENYVQPLNLKQLAVMADMSVAQ
LERYFHKVFHLTPRQVLLKTRLDAATALLVSHDKVTDVAALCGYTDHSAFTRQFKATVGV
TPTEYRMLLHGTSRS