Protein Info for H281DRAFT_03209 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 50.3 bits, see alignment E=2.4e-17 PF00486: Trans_reg_C" amino acids 148 to 224 (77 residues), 64 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_4121)

Predicted SEED Role

"Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGN0 at UniProt or InterPro

Protein Sequence (240 amino acids)

>H281DRAFT_03209 DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain (Paraburkholderia bryophila 376MFSha3.1)
MRIAILQRDPVMRQSIEKILTSAGHTCAGYDDGLTMSKTLARSTVDLLVLDWHGTRLSGT
EVLRTARAVGGDRVPVIFVSRDTSEESMVRAFVNGADDYTALPVRPAEFRERVAAMLRRA
YPDRFSTSSFDVGPYRFDTHRQIVMLRGQPVSLSGTQYRLASLFFSNIGRVMSRDHIFAM
VWGREFREFTRTIDSHVSRLRLLLEIEPQNEFRLQPVYKSGYRLLHLRQEEAIHEQQQAA