Protein Info for H281DRAFT_03199 in Paraburkholderia bryophila 376MFSha3.1

Annotation: flagellar transcriptional activator FlhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF05247: FlhD" amino acids 4 to 103 (100 residues), 141.6 bits, see alignment E=4.7e-46

Best Hits

Swiss-Prot: 60% identical to FLHD_BURP1: Flagellar transcriptional regulator FlhD (flhD) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: K02403, flagellar transcriptional activator FlhD (inferred from 96% identity to bge:BC1002_4403)

Predicted SEED Role

"Flagellar transcriptional activator FlhD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG64 at UniProt or InterPro

Protein Sequence (106 amino acids)

>H281DRAFT_03199 flagellar transcriptional activator FlhD (Paraburkholderia bryophila 376MFSha3.1)
MDRSSETLDSIREINLSYIMLAQRMLREDKPIGMFRLGLSSELADLLAGLSLAQIVKLAS
SDQLLCFFRFNDHSMLSALTQTTKHTAVAPTHAAILLAGQPAEQFA