Protein Info for H281DRAFT_03196 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02771: Acyl-CoA_dh_N" amino acids 34 to 121 (88 residues), 33.4 bits, see alignment E=1e-11 PF02770: Acyl-CoA_dh_M" amino acids 133 to 213 (81 residues), 37.6 bits, see alignment E=4.1e-13 PF08028: Acyl-CoA_dh_2" amino acids 245 to 375 (131 residues), 56.8 bits, see alignment E=6.1e-19 PF00441: Acyl-CoA_dh_1" amino acids 246 to 372 (127 residues), 37 bits, see alignment E=7.8e-13

Best Hits

Swiss-Prot: 43% identical to SFNC_PSEPU: Probable FMNH2-dependent monooxygenase SfnC (sfnC) from Pseudomonas putida

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_4134)

MetaCyc: 40% identical to DszC (Rhodococcus sp. IGTS8)
RXN-621 [EC: 1.14.14.21]; 1.14.14.21 [EC: 1.14.14.21]

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>H281DRAFT_03196 Acyl-CoA dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MNDFRQTAALQTREASAAPTVRDLAGLLAALHASAAERDLAGGHAAQEKQWIADAGLLTL
AVPREFGGEGASWPEIYDTIRKIAQVDSALAHLLGFTFLQEVSVYVWGNAEQRDRYLGGT
VKERWWWGNAVNPLDTRLVANATGDGGYVLNGEKGFCSGTRGSHMMTVSGHDPQTGSTMF
AVVPTTREGITVNEDWNPIGQRQTDSGSVSFVQVRVEPEEVLQRGDTPYASLRTLVSQQV
MTNLFVGIAQGALEEARAYVSQYGKPWMTSGVTKATDDPYLIQRFGEMRIQAVSAEALAV
RAAQALDAAWREGPSLSAEARAHVALATSEAKIVAHRAALDVSEKLFDACGARATHAPLA
LDRFWRNARVHTLHDPLDYRVRDVGRYALSGTLPEVSLYT