Protein Info for H281DRAFT_03191 in Paraburkholderia bryophila 376MFSha3.1

Annotation: outer membrane protein, multidrug efflux system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 364 to 384 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 19 to 498 (480 residues), 397 bits, see alignment E=5.9e-123 PF02321: OEP" amino acids 93 to 285 (193 residues), 104.1 bits, see alignment E=4.2e-34 amino acids 310 to 496 (187 residues), 103.7 bits, see alignment E=5.6e-34

Best Hits

KEGG orthology group: None (inferred from 93% identity to bgf:BC1003_5277)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGE4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>H281DRAFT_03191 outer membrane protein, multidrug efflux system (Paraburkholderia bryophila 376MFSha3.1)
MKRFESLSGWGRAAASGLLLALLAACSVEPTYKRPEVDTPTAFKEAPVAASGATEASAPS
AASAPDAGTWKTAQPADDAHRGEWWKIFGDAQLDALEEQAAAANQDLKAAAARVQQARAV
TRAAKSDWFPKFDAGFGPTRERASAASQFQPDSAGGTTGTIWRAQVGASYEADLFGRVGS
NVNASRADEQQSEALFRSVQLSLQADVAQNYFQLRELDTDQDLYRRTVALREDTLKLVER
RFKEGDISELDVSRARNELASARADAVGVARQRAASEHSLAILLGKPPADFSFAEAPLVP
VAARVPPGLPSALLERRPDVSAAERAMAAANARVGLAKSAFFPKLDITGAFGYESATLGN
LFMWSSRAFILGPFAGTALTLPLFDGGRRKANLAQARAKYDEDVAQYRQQVLVAFREVED
NLADLRLLDDQMREQNNAVQASQRAARLSRTQYTEGAVSYLDVIDGERQVLSTQLQASHL
QGTQAVATVNLIRALGGGWGDVAASDTAVGSAAPAATPASSAAPAEQVARR