Protein Info for H281DRAFT_03169 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF16927: HisKA_7TM" amino acids 9 to 215 (207 residues), 35.9 bits, see alignment E=1.2e-12 PF14501: HATPase_c_5" amino acids 353 to 445 (93 residues), 22.5 bits, see alignment E=1.3e-08 PF02518: HATPase_c" amino acids 354 to 457 (104 residues), 82 bits, see alignment E=6.4e-27

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_4161)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGC4 at UniProt or InterPro

Protein Sequence (476 amino acids)

>H281DRAFT_03169 Signal transduction histidine kinase (Paraburkholderia bryophila 376MFSha3.1)
MYAIPTAFVSAMFVVFGLYVVITQGVTRLSVPFLLMCAATFAWQGTWTLLFQTKDTEVAG
LLVRVGYLFILFLPTTFYHFVTEVAARRRERPLLLASYGLCFVLAVLLPGNEVVAGYQHY
FFGYYPIAGPLHPLHVVQTVLLAARSGQLLLGARKNAGGQGRRRLDLCLAALGLYSFAAV
DYAVNYGYPFYPPGVLFIALSLGLLAITIVRYHLIHPYALAATIAHEIATPLATIGMHAD
EIASVWSHVFKGYRLAVAHGLYDDEEHSGQSERISQLATAIRREVSGTSAMVEMALASYT
LDRLDRSRFSAHPVRQCVDSALERYPFRADERERITILPIDPMLRFSGSDTVVVFVLFNL
LKNALHAIHVKGEGQITISALEDQDFCMLQFRDTGPGIAPDVLPHIFDAFFSTKRHGSGA
GMGLAFCRRATELLGGSIECTSVRGAHTTFIVRLPLPGSAADRALSRSPVREARRR