Protein Info for H281DRAFT_03158 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 47 to 205 (159 residues), 94.2 bits, see alignment E=3.5e-31 PF00990: GGDEF" amino acids 49 to 201 (153 residues), 112.4 bits, see alignment E=1.9e-36 PF00563: EAL" amino acids 225 to 457 (233 residues), 251.9 bits, see alignment E=5.6e-79

Best Hits

KEGG orthology group: None (inferred from 69% identity to bug:BC1001_4173)

Predicted SEED Role

"Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>H281DRAFT_03158 diguanylate cyclase/phosphodiesterase (Paraburkholderia bryophila 376MFSha3.1)
MTQQVSVLPASRSHAKSRSASRSAPSHHAHNSGVIAQSPDPGNVARASSFDLLTGVYDRA
CATRRAGHLLAAAKAGDVAMLVVNLDGFSRINDIAGYDLGDRLLRRVAQRLASSISEDEL
LARIGGDEFVIVMHRFGDVSRLTRFAQQVLASFGEPFVIAGREYRVRASVGVAVSGDNVR
NAASLMRDAGAAMRHAKRCGRGTVCFFTGEMREGVQRRFAIEGLLHHALARGEFRLAYQA
VVDATSRKTIGVEALARWTSNELGDVPPAEFIPVAEQAGLMESIGDWVLEMACAQAADWR
WSIAPDIAVSVNISPSQFSERLVRHVAACLDNSGLEPSALQLEITEGMQLPDDAAVRATT
AALAKLGVKLVIDDFGTGYASMSYLKRFPVDSLKIDRSIVAGLPRDADSVAITHALVTMA
HACNMRVTAEGVETEAQAVTLREIGCDALQGYLFSRPCNAAECAAALSRRPIRMKNCHVH
K