Protein Info for H281DRAFT_03139 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 416 to 431 (16 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 25 to 283 (259 residues), 94.7 bits, see alignment E=4.2e-31 PF03631: Virul_fac_BrkB" amino acids 31 to 284 (254 residues), 177 bits, see alignment E=5.7e-56 PF19029: DUF883_C" amino acids 404 to 427 (24 residues), 31 bits, see alignment (E = 1.7e-11)

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 88% identity to bug:BC1001_4191)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>H281DRAFT_03139 membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MDIDTLSAENLQHAARQQANWAIGALKQFSEDRCTAMAASIAFYAAFSLAPTLVMVIAVA
GWFFGAEAARGELFDHIHGLLGDQAAAGVQTIVENAHHSGSAGGVAAIISFSMLAIGASA
TFSSLNSALNVVWPNTGPRTSSVIALVRVRLISFGLVLGVAFLLIVSLVLDTVITFIGKW
LWGDSPYVVIGNLLQLGVGLLVLAFAFAGLLKFLPDAKVRWRDALVGGVVAAVLFSAGKK
LFALYLAHAGMASSFGAAGSLAVLLMWLYFSAAVLLLGAEFSAARGRLNDPRGGWGMQAD
SPPGSRAKLASVLAASTVPANAALHAGAEASGYDAPTASPGSAHAETGAGTQAAYDLRRM
QLRKKASARATALNVGRSVISAEAQATHLAAVTLLGASRKAVEADRYVRKHPWKSVALAA
AAGLAAATIARHNRDDDIAPK