Protein Info for H281DRAFT_03116 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13531: SBP_bac_11" amino acids 36 to 294 (259 residues), 59.5 bits, see alignment E=8.9e-20 PF01547: SBP_bac_1" amino acids 40 to 287 (248 residues), 67.2 bits, see alignment E=5.1e-22 PF13416: SBP_bac_8" amino acids 49 to 309 (261 residues), 131.7 bits, see alignment E=9.4e-42 PF13343: SBP_bac_6" amino acids 84 to 333 (250 residues), 81 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to bgf:BC1003_5200)

Predicted SEED Role

"Spermidine/putrescine-binding periplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFW7 at UniProt or InterPro

Protein Sequence (348 amino acids)

>H281DRAFT_03116 putative spermidine/putrescine transport system substrate-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MKLFRTIAALAALCAFGAAAPAWSQTKTIYIGMNGGPMEKAYTSQVLPDFEKANNVKVVV
VPGTSSDILAKLLANKASPQIHVVFLDDGVMARAVSMGVCKKLDDSPVLKELYPFARMKD
DMGAGVQLGMTGIAYNKKLFAEKGWAPPTSWMDFADPKYKGKVVFQSASSSTFGLHGFLA
INRLMGGTEQNVEPGFTKWASTVGPNVVEYVPNSAKISEMVQTGEAGLFPLTPTAVGDLA
DKGIPVGYVNPKEGPVLLLVDLCVVNNNPDPQLAQKLAQFLLSAPAQTKAAEAGRQIPTN
RLAKMTPPMQQSLGNVEDLVRKVTVVDWDTINAHRAQWDTRWNRQIER