Protein Info for H281DRAFT_03073 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sulfane dehydrogenase subunit SoxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR04555: sulfite dehydrogenase" amino acids 16 to 425 (410 residues), 588 bits, see alignment E=4.9e-181 PF00174: Oxidored_molyb" amino acids 109 to 277 (169 residues), 161.2 bits, see alignment E=1.9e-51 PF03404: Mo-co_dimer" amino acids 296 to 412 (117 residues), 66.6 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 89% identity to bgf:BC1003_5156)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>H281DRAFT_03073 sulfane dehydrogenase subunit SoxC (Paraburkholderia bryophila 376MFSha3.1)
MTPSKTSPDLPPSRSRRRLLGRLAAGGLVASQAAAAGELLRPLEVAPSSRTPGAPVLDHP
YGVPSPREADVVRRSARAWPLPGAASSMTPLADLFGTITPNGLVYERHHGGVPDINPDQH
RLAIHGLVRTPKLFTMDDLLRLPAESRIHFLECSGNTGSEWNGPSGLPVQLTHGLLSCCE
WTGVRLSTLLEEVGGVSTQGKTKDGPWLLAEGADAAAMTRSLPLHRILDRALVVYAQNGE
RLRPENGYPLRLIVPGFEGNTNVKWLRRLKVVDAPLQTREETSKYTNLLADGSARQFVFE
MDAKSVITRPSPGHRLTTHGYYPISGIAWSGRGTICKVEVSTDGGASWRLARLESAARDR
ALTRFEADWRWDGAPSAIVSRATDSTGYVQPTRAELVAARGLNSQYHYNAIQQWRVDASG
EVRNA