Protein Info for H281DRAFT_03071 in Paraburkholderia bryophila 376MFSha3.1

Annotation: two-component system, OmpR family, response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 110.5 bits, see alignment E=5.2e-36 PF00486: Trans_reg_C" amino acids 160 to 235 (76 residues), 74.4 bits, see alignment E=6.3e-25

Best Hits

Swiss-Prot: 46% identical to OMPR_ECO57: Transcriptional regulatory protein OmpR (ompR) from Escherichia coli O157:H7

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 94% identity to bpy:Bphyt_4604)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMJ7 at UniProt or InterPro

Protein Sequence (246 amino acids)

>H281DRAFT_03071 two-component system, OmpR family, response regulator (Paraburkholderia bryophila 376MFSha3.1)
MDTIDHVLIVDDDRGIRELIAGYLEKNGMRVSLAANGRQMRAVLDQGAPDLIVLDLMMPG
EDGLVLCRELRASKFRTVPVLMLTARNEEADRILGLEMGADDYLPKPFAVRELLARIRAV
LRRARMLPPGMQVTETAQMLEFGDWRLDTTARHLLDSEGTMVALSGAEYRLLRVFLDNPQ
RVLTRDQLLNLTQGRQADQFDRSIDLMVSRLRQRLRDVAREPRYIKTLRSEGYVFSASVS
AIEDQQ