Protein Info for H281DRAFT_02997 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ABC-2 type transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 53 to 82 (30 residues), see Phobius details amino acids 89 to 131 (43 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 5 to 216 (212 residues), 118.6 bits, see alignment E=2.8e-38 PF12698: ABC2_membrane_3" amino acids 54 to 243 (190 residues), 35.4 bits, see alignment E=6.9e-13

Best Hits

Swiss-Prot: 41% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 99% identity to bxe:Bxe_B2276)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MM17 at UniProt or InterPro

Protein Sequence (253 amino acids)

>H281DRAFT_02997 ABC-2 type transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MNLYAIRAIYKFEMARTWRTLMQSIIAPVISTSLYFVVFGAAIGSRIKEVDGISYGAFIV
PGLIMLSLLSQSISNASFGIYFPRFTGTIYELLSAPVSYLEIVVSYVGAAATKSILLGLI
ILATAGLFVPLQVQHPFWMILFLVLTAVTFSLLGFIIGIWADSFEKLQLVPLLIITPLTF
LGGSFYAVNMLPPFWKVVTLFNPIVYLVSGFRWSFYGLADVNVEVSLAMTALFLAVFLAI
VAWIFKTGYRLKS