Protein Info for H281DRAFT_02986 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Tetratricopeptide (TPR) repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF13432: TPR_16" amino acids 18 to 73 (56 residues), 23.5 bits, see alignment 3.3e-08 amino acids 104 to 146 (43 residues), 24.7 bits, see alignment 1.5e-08 PF07719: TPR_2" amino acids 115 to 146 (32 residues), 24.2 bits, see alignment (E = 1.4e-08) PF07721: TPR_4" amino acids 115 to 138 (24 residues), 16.5 bits, see alignment (E = 5.6e-06) PF13181: TPR_8" amino acids 116 to 146 (31 residues), 15.9 bits, see alignment (E = 6.3e-06) PF13414: TPR_11" amino acids 126 to 161 (36 residues), 32 bits, see alignment 4.3e-11 PF01075: Glyco_transf_9" amino acids 423 to 455 (33 residues), 25.9 bits, see alignment (E = 3.3e-09)

Best Hits

KEGG orthology group: None (inferred from 80% identity to bug:BC1001_5161)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>H281DRAFT_02986 Tetratricopeptide (TPR) repeat (Paraburkholderia bryophila 376MFSha3.1)
MQNQSPVSPQAISLWFNEAEEARLAGRFDTAQALLDRIIVHDSAHAAALYSRGLVALAQD
QLPLAQRWIERAVEVEPQPPFFDMLCLVQIRLRAFASIVHTASAGLTYQPDSLSLHYYLG
VALQLQGRAEEAAAVYRRLIELKPDYVQAHANLGIVVKDLGSLSKAEQHLRHAMTLDPSN
RGARASLSQVLLAAGRYEEAWPYFEDRWANFVDADGQPVSQRSELPWPQWKGEDSGVAGG
ARLLVLPEQGHGDSLQFVRYLPLALERFAQVGYICPPSLRRLYEESLCVRWPGLVMLDDV
MPDAKEWDWQCPLMSLPLAFGTRLDNIPAEPYLRAEPQRSAEWRAKLGELSRPDLPRVGV
VWAGGHSGLTEDRARSLTSAQFAPLLSLSRIRWISLQKADDLAKRASPSTKAYLTDWMDG
VSDFADTAAIIDNLDLVISVDTSVAHLAAAMGKPVWLLNRFAGCWRWLRNRDDSPWYPTV
RIFTQPQRGNWDEVIERVAAQLKQRYEPGITYRSFVR