Protein Info for H281DRAFT_02946 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 395 (363 residues), 156.3 bits, see alignment E=1e-49 PF00083: Sugar_tr" amino acids 61 to 429 (369 residues), 23.4 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 49% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 58% identity to hse:Hsero_2252)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>H281DRAFT_02946 D-galactonate transporter (Paraburkholderia bryophila 376MFSha3.1)
MSINPPATMPYAEATLDERGVYSKVSWRLIPFLLICYTAGYLDRVNVGFAKLQMLDQLKF
SETVYGLGAGIFFLGYVIFEVPSNIVMHKVGARIWIARIMITWGLISAAMVFVKTPTTFY
VMRFLLGVAEAGFLPGILLYLTYWYPSSRRGRIIALFLAGIPLAGMLGGPLSGWIMHASS
NISGWSGWQMMFLLEALPSVLLGIAVFFVLGNDVRSAKWLTEAEKQLLAANLERETPESQ
VNSLRGAFTEPRTWILCVMYAFILMGEYGVLFWMPTIIKDTGVTDPLQVGMLTAIPYTAT
VLAMFVVGWHSDRTRERRWHLALPGIVAAIGLALVAMYPHSTVIAVCGLTIGTVGVLSVV
SQFWTLPPALLGGVAAAAGIALVNSVGNLAGFVSPYMLGWIKQNTGTTSIGLYILAASMI
VGSAMVFCFPSRLIDR