Protein Info for H281DRAFT_02923 in Paraburkholderia bryophila 376MFSha3.1

Annotation: alkylhydroperoxidase AhpD family core domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02627: CMD
  • amino acids 23 to 102 (80 residues), 75 bits, E=1.8e-25
• TIGR00778: alkylhydroperoxidase AhpD family core domain
  • amino acids 42 to 88 (47 residues), 53.6 bits, E=5.8e-19

Best Hits

Swiss-Prot: 46% identical to Y1053_HAEIN: Uncharacterized protein HI_1053 (HI_1053) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_3751)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
• superpathway of aerobic toluene degradation (16/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Protein Sequence (116 amino acids)

>H281DRAFT_02923 alkylhydroperoxidase AhpD family core domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MLNWTEYRKQLFGRIGEIGKLSPDTVKGYQTLSNAGQKNDLLGAKTRELISLAVAVSLRC
EGCITVHTAEALKQGATREEIAEALGVAVAMNAGATMVYSARTMDAVAAYSAEASA