Protein Info for H281DRAFT_02921 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 86 to 103 (18 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details PF06081: ArAE_1" amino acids 44 to 175 (132 residues), 32.8 bits, see alignment E=7.2e-12 PF13515: FUSC_2" amino acids 48 to 171 (124 residues), 57 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 87% identity to bug:BC1001_3749)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen and teichoic acid"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKM2 at UniProt or InterPro

Protein Sequence (190 amino acids)

>H281DRAFT_02921 Predicted membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MTPHDDPAQTTRASAAESLFAFLKSLPFAERLTEGSLMAFQAVAGASLAFEIGQALHTEQ
AFWAAITAIAVSQHSYVDTRKLSRDQFIGAMVGGLCGLAGATLGHGYFAAYAATVAVAIV
LCWIVNVGSAARLGGITATIMLLVPGIGPAWDKALLRLGEVTLGTVCALLVAWLMARAEK
RWFSTPGKAR