Protein Info for H281DRAFT_02904 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-lactate dehydrogenase complex protein LldF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 66 to 282 (217 residues), 116.7 bits, E=2.3e-37
• PF13183: Fer4_8
  • amino acids 303 to 368 (66 residues), 42.7 bits, E=1.4e-14
• PF00037: Fer4
  • amino acids 304 to 317 (14 residues), 21.8 bits, see alignment (E = 2.5e-08)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_3731)

MetaCyc: 47% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• methylglyoxal degradation V (2/3 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

See A0A2Z5MI78 at UniProt or InterPro

Protein Sequence (463 amino acids)

>H281DRAFT_02904 L-lactate dehydrogenase complex protein LldF (Paraburkholderia bryophila 376MFSha3.1)
MSRIDHAKAAGEFIKKTEHVAFHDKRLWDLREKRDAQAHGIAEWETLRELASGIKEHTLS
HLSEYLEQFAASAEANGVVVHWAATAEEHNALVHKIMSERGMTTLVKSKSMLTDECKMRE
YLEPRGITVMETDLGERIQQLDHQDPSHMVVPAVHKLRADVAELFGRTIGTDPHNSDIHY
LAESQRMNTRPYFVREKTAGMTGCNFAVAETGTVVVCTNEGNADLSANVPPLHIASIGIE
KLIPKVSDLGVFIRMLSRSALGSPITQYTSHFRAPRPGTEMHFILVDHGRSERLAMDDFW
YSLKCIRCGACMNTCPVYRRSGGLSYGGTYSGPIGAIINPTFDLKRYSALPFASTLNGSC
TNVCPVKINIHEQIYKWRTVIAERHEVPFVKQEVLKMAGRLLASPTLYRATVASMSGALR
RLPNFVLYNPLNIWGRQRELPDAPKQTFHAWYKQNRGGGDGNA