Protein Info for H281DRAFT_02899 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF20161: VpsR" amino acids 3 to 124 (122 residues), 93.1 bits, see alignment E=2.7e-30 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 229.7 bits, see alignment E=4.3e-72 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 77.3 bits, see alignment E=3.5e-25 PF00004: AAA" amino acids 173 to 305 (133 residues), 23.8 bits, see alignment E=1.3e-08 PF02954: HTH_8" amino acids 408 to 441 (34 residues), 41.7 bits, see alignment (E = 1.9e-14)

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_3726)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKK2 at UniProt or InterPro

Protein Sequence (483 amino acids)

>H281DRAFT_02899 DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains (Paraburkholderia bryophila 376MFSha3.1)
MNMTFASADTERTVLYVSNSPDKKLADFLAASAWHAVHAKTTASAERMIERDNIKVGLIE
LPEDCTSQQLSALASCMRRPETNWVAQIAPGQADDELISRFILDYCFDFVTRPWLNERLV
FALGHAHGLSALRQAHVTPEPSLGRHGMVGQCEAMQQLYRRIDKCGTTEAPVFVAGESGT
GKELTARAIHERSPRAGRPFVAINCAAIPPTLLQAELFGHERGAFTGALQRKIGRIESAH
EGTLFLDEIGDMPHECQAVLLRFLQEGTIERLGGNGPIHVNVRVISATHVDLDKAVKEGR
FRSDLYHRLCVLRLVEPPLRERGGDIKLLANYALSMYKQDGARKLRGLSSDAIVAMSNYA
WPGNVRELINCVRRAVVMSEGRFINASDLGLPETDNGPAVTLAEIRSKAEKDAIEHALQR
HGYKLSEAAAELGISRATLYRLMHADRLHAEPSGGRTSNADLDGDADGEREPRMPIPMSA
ASA