Protein Info for H281DRAFT_02886 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 1-aminocyclopropane-1-carboxylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR01274: 1-aminocyclopropane-1-carboxylate deaminase" amino acids 2 to 337 (336 residues), 662.1 bits, see alignment E=7.6e-204 PF00291: PALP" amino acids 12 to 321 (310 residues), 169.2 bits, see alignment E=7e-54

Best Hits

Swiss-Prot: 97% identical to 1A1D_PARPJ: 1-aminocyclopropane-1-carboxylate deaminase (acdS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 99% identity to bug:BC1001_3713)

MetaCyc: 40% identical to L-cysteate sulfo-lyase subunit (Ruegeria pomeroyi DSS-3)
L-cysteate sulfo-lyase. [EC: 4.4.1.25]

Predicted SEED Role

"1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)" (EC 3.5.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.7 or 4.4.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKJ2 at UniProt or InterPro

Protein Sequence (338 amino acids)

>H281DRAFT_02886 1-aminocyclopropane-1-carboxylate deaminase (Paraburkholderia bryophila 376MFSha3.1)
MNLQRFPRYPLTFGPTPIQPLKRLSDHLGGKVHLYAKREDCNSGFAFGGNKTRKLEYLIP
EALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIQMSR
ILGADVRLVPDGFDIGFRKSWEDALESVRAAGGKPYAIPAGCSDHPLGGLGFVGFAEEVR
QQEAELGFKFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQITRIAS
RTAEKVGLGRDITANDVVLDERFGGPEYGLPNDGTLEAIRLCARLEGVLTDPVYEGKSMH
GMIDMVRNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG