Protein Info for H281DRAFT_02880 in Paraburkholderia bryophila 376MFSha3.1

Annotation: chemotaxis protein methyltransferase CheR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF03705: CheR_N" amino acids 18 to 68 (51 residues), 38.3 bits, see alignment 9e-14 PF01739: CheR" amino acids 83 to 261 (179 residues), 108.4 bits, see alignment E=3.4e-35

Best Hits

Swiss-Prot: 56% identical to CHER3_PSEPK: Putative methyltransferase Cher3 (cheR3) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 96% identity to bug:BC1001_3707)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI50 at UniProt or InterPro

Protein Sequence (281 amino acids)

>H281DRAFT_02880 chemotaxis protein methyltransferase CheR (Paraburkholderia bryophila 376MFSha3.1)
MSQFELDARQRMSDFDIELKLLLEAIYLKYQHDFRHYAMSSLRRRLSQALDEFGLSTLSQ
LQDRIMRDSDQFSRLFQYLTVQVSDMFRDPAYFLALREHVLPRLRTYPSIKVWVAGCSTG
EELWSLKILFDEEGLTERTLFYATDISPDALARAEAGIYALDRVQGFTQNYLAAGGKRSL
SDYYHAAYNGARFAGSLKGRVVFADHSLSTDEVFLEAHLVSCRNVLIYFDRGLQDRALGL
FENALVRRGFLGLGSKETLRFSSHYEAFDEFRPGERIYQKR