Protein Info for H281DRAFT_02870 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted PurR-regulated permease PerM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 245 to 272 (28 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 339 to 368 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 32 to 142 (111 residues), 41.1 bits, see alignment E=6.5e-15 amino acids 191 to 365 (175 residues), 115.1 bits, see alignment E=2.1e-37

Best Hits

KEGG orthology group: None (inferred from 91% identity to bgf:BC1003_3746)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIC6 at UniProt or InterPro

Protein Sequence (649 amino acids)

>H281DRAFT_02870 Predicted PurR-regulated permease PerM (Paraburkholderia bryophila 376MFSha3.1)
MKISLPPHGRSNRVYPPAAPSLHGLASVITGVVVVCALYFGRAVLIPITLSVLLSFLLAP
LVQMLRRLHMGQLPSIFIAVLFALAALLAVGALIGAQLVQLAGDLPQYQVAIERKIETVQ
EKTIGRADSLMSRAAATLQRVAPSKPPPRPTGRAARNAPAVPTPVEVHEPSPTPLQLAQR
ALSPAIAPIETTFIVLVVTIFILLQREDLRDRLISLFGSRDLHRTTTAINDAAVRLSRYF
VAQLGVNLSAGGVIAIGLAIIGVPGALLFGVIAALLRFVPYIGIWIAAILAVFLAAAIQP
QWTMAVYTLILFIVVDVVAGQIAEPLLYGHRSGLSPLAVVVAAIFWSWLWGPIGLVLSTP
LTLCVVTLGRYADRLNFLTVLLGDQPALTPAQNFYQRLLADDPHEAIVQAERLLREMSLI
DYYDTVALEGLKLARNDAMRGVLMPDQLARVNEALVDIVENLEIADGLPDRLIRAESPEA
LVAASSADLSERNDSSTRAHASPQSDSEKAAVLCVPGRGAFDEVTTAIAVQLLGRFGFAP
IMATHSGYRSAHADEPSYKNAPIICIVTLDAPESPPYLRNMLRRTRQWRPRAALVVGVGG
TAENGHETGTGATAASHSAPTFRAMIEECQLAASSLHTRQHSHVASSAD