Protein Info for H281DRAFT_02821 in Paraburkholderia bryophila 376MFSha3.1

Annotation: YihY family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 33 to 59 (27 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details PF03631: Virul_fac_BrkB" amino acids 30 to 284 (255 residues), 106 bits, see alignment E=1.3e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_3650)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJJ1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>H281DRAFT_02821 YihY family inner membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MYSIIDQRTLNVAKHPGRFLLETMKAFRANQGLLLAGAVAYYALLSIVPLMILIVIALSR
IVPQHILLPALGHLLQWLVPGQSAALVRELANFLAHRAVIGWVLFVTMLFFSSLAFTVLE
NAMSLIFVHRVVIRRRHFLLSALLPYCYILFLGVGALIVTLVSSGLEAVGAEGIDLFGLH
VSLQGASRVLLYLLGLAGEVFLLTSIYMVMPVGRPSLKHALFGGIVAALLWEITRHVLVW
YFATLSQVSVVYGSLTMAIVILFSLEWLATLLLFGAQVIAQYERFGIEPQNAPKQPIKTG