Protein Info for H281DRAFT_02810 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted PurR-regulated permease PerM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 272 to 302 (31 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 190 to 372 (183 residues), 111 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: None (inferred from 86% identity to bgf:BC1003_3698)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (682 amino acids)

>H281DRAFT_02810 Predicted PurR-regulated permease PerM (Paraburkholderia bryophila 376MFSha3.1)
MKDFPEPSRGRHPTRIDAPPAAFGLDALIALAVGAGLVACLYFARAVLIPMTLAILLSFL
VAPLVKSLGRLKLGHVASVFAAVVISVSVIGVLGAVIAMQLTDLAAGMPRYQATIEHKME
AAHTLTVGKLDRFAKAAGQALQRATVEPTPPAPRRDASSSDGRAPAAVPVEVREPVPTPL
ELARRVLSPAISPLETAFIVFVVMVVILLQRDDLRDRAIRLFGSRDLHRTTTVMDEAARR
LSRYFVSQLGLNAGLGVVIGAGLFLIGVPSPILWGILAALLRLVPYVGIWIAGGLATALA
AAVSPGWDMAIWSIALFVTVELLVGQVVEPLLYGRSTGLSPFSVVVAAIFWSWIWGPIGL
ILSTPLTLCLLVLGRHIRRLEFLDVMLGDQPALTPIENFYQRVLAGDPDEALAQAELLLR
ERSLSAYYDEVTIPGLQLAANDVVRGSVTSVQLARIESTTNDLIDGLDGYPDEQPPRLMA
EDAGTDIGPVAPSHIAPAASAGMHALFANHMSRGAAQGPRDDSAQQAADDALEEAEDPPR
AANQRVLCIPGRGPLDPLASTILLQLLGKHGFTARALPHEAASRASIEQMDADDVGVVCI
VYLRIDGVPSHLRYMVRRIRARLPNASIIVGLWAREDLEKWSVDLQNAMGAECYVTSLQE
MLAACRMCASTTSGEPLAVADV