Protein Info for H281DRAFT_02735 in Paraburkholderia bryophila 376MFSha3.1

Annotation: AraC family transcriptional regulator, activator of mtrCDE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 173 to 191 (19 residues), see Phobius details PF12852: Cupin_6" amino acids 6 to 192 (187 residues), 123.3 bits, see alignment E=1.5e-39 PF12833: HTH_18" amino acids 235 to 311 (77 residues), 72.7 bits, see alignment E=3.8e-24 PF00165: HTH_AraC" amino acids 277 to 311 (35 residues), 28.4 bits, see alignment 2e-10

Best Hits

KEGG orthology group: None (inferred from 74% identity to bph:Bphy_6295)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI21 at UniProt or InterPro

Protein Sequence (320 amino acids)

>H281DRAFT_02735 AraC family transcriptional regulator, activator of mtrCDE (Paraburkholderia bryophila 376MFSha3.1)
MSLTLDWLSRLLGMMTVRGQLELRCSYGAPWQVIYDDSAAGEMPYHIVLGGSAILETPGE
GKPQDLGAGDIVMLTHGSAHILHDGSGARPKPARQRQTLNLTVSENKGSGQRLEMLCGRI
VLAPPHDRLIRAYLPPRLVVRTSAAGASSSAETLAQLKGLMALLQAESSADRLGGYAMLN
ALSTALFALALRMSGESDEAPTGLLALAGHPRLAPALAAIFNDPAYPWTLSELSELCSMS
RATLLRHFQDKVGRSPNELLTDVRMALAANELKKPGVSTEVVAETVGYQSVAAFRRAFTQ
HLGMTPADWRRSEDKQHGQS