Protein Info for H281DRAFT_02709 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00392: GntR" amino acids 54 to 115 (62 residues), 60.9 bits, see alignment E=7.3e-21 PF07702: UTRA" amino acids 140 to 273 (134 residues), 80.7 bits, see alignment E=9.5e-27

Best Hits

Predicted SEED Role

"Predicted transcriptional regulator of N-Acetylglucosamine utilization, GntR family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHR3 at UniProt or InterPro

Protein Sequence (282 amino acids)

>H281DRAFT_02709 GntR family transcriptional regulator (Paraburkholderia bryophila 376MFSha3.1)
MLRERRASLPASRARRETKPREIPYKNIRCLMYIWSSDERESNMRLSVERSMSDKIQESL
LTMIRERKLKPGDQIPTELELCELLGVGRSSLREAVAQMISHGLLSRVQGRGTFIRQISL
KLQGGLDDLMSVTDMIRSVGAVPSTSRIQMDSIAASESLAEKLGIAPGETCIRIERVRRA
DDAIAAYCIDTIPKTLFDEAQGELGESLFGMFARTGRRLSHTHTSIQPTILTPRDLPELG
DGFGMFLLLDEVDFDQSGEPLCYSNDYYNTSIFKFDLVRKRR