Protein Info for H281DRAFT_02707 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methylthioribose-1-phosphate isomerase (EC 5.3.1.23)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 13 to 341 (329 residues), 435.2 bits, E=1.5e-134
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 41 to 340 (300 residues), 361.3 bits, E=3.7e-112
• PF01008: IF-2B
  • amino acids 53 to 340 (288 residues), 298.1 bits, E=3e-93

Best Hits

Swiss-Prot: 52% identical to MTNA_MOOTA: Methylthioribose-1-phosphate isomerase (mtnA) from Moorella thermoacetica (strain ATCC 39073 / JCM 9320)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 63% identity to dap:Dacet_2111)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• 5'-deoxyadenosine degradation II (3/4 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (1/7 steps found)
• L-methionine salvage cycle III (3/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

See A0A2Z5MJP6 at UniProt or InterPro

Protein Sequence (359 amino acids)

>H281DRAFT_02707 methylthioribose-1-phosphate isomerase (EC 5.3.1.23) (Paraburkholderia bryophila 376MFSha3.1)
MVAQSLFPALAPTIEWRDDALLLLDQTRLPHEVVVEHVADAAAVWRAIHELRVRGAPAIG
VAAAYGLCVAVQDARALPLAQFRAELERRARWLNTARPTAVNLSWSLGRMLQRAHTCGAS
DSTALYEALVEEARQIHAEDQTLCEGIGRHGMPLIKQGCGVLTHCNAGALATTGLGTATA
PIYAAHREGIAFKVFADETRPLLQGARLTAFELQQAGVDVTLIMDSAAASIMSQGLVDVV
IVGTDRVAANGDFANKIGTLGVAIAAKHYGIPFYVACPSSTLDFRTPTGAQIEIEERCDE
EVTHFAGQRTAPHGIKARNPAFDVTPHELVTGFITERGIAKAPFERSLGQFFPAAGNAA