Protein Info for H281DRAFT_02683 in Paraburkholderia bryophila 376MFSha3.1

Annotation: xanthine dehydrogenase accessory factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF02625: XdhC_CoxI" amino acids 15 to 83 (69 residues), 83.3 bits, see alignment E=9.3e-28 PF13478: XdhC_C" amino acids 165 to 307 (143 residues), 130 bits, see alignment E=7.6e-42

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 76% identity to bph:Bphy_0089)

Predicted SEED Role

"Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>H281DRAFT_02683 xanthine dehydrogenase accessory factor (Paraburkholderia bryophila 376MFSha3.1)
MDSVNLEVLKASARWIESGRRVLLVTVVRTWGSSPRPEGAMLAILDDGSVAGSVSGGCIE
DDLIDRVRRQGIEQTRPEVLRYGISADEAHRFGLPCGGTIELVLEPLTRASGIDELCRRV
MAGQLVARSLDMKSGAVKLLPAHSADGMDFNGRMLLTVHGPRYRMLVIGAGQLSKYLCQI
ALGLDYQVTVCDPREEYTDVWRLPGTTLVRTMPDDTVLDMKLDERCAVIALTHDPKLDDL
ALMEAVRTPAFYVGALGSRRNNAARRERLETHFDLTDDELSRLRGPIGIYIGSRTPPEIA
VSILAEVTAVRNGVVLPGEFRIEDAKARLDVAVNEQTNCAITAHH