Protein Info for H281DRAFT_02645 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAS domain S-box-containing protein/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR00229: PAS domain S-box protein" amino acids 134 to 263 (130 residues), 78.4 bits, see alignment E=5e-26 PF13188: PAS_8" amino acids 138 to 190 (53 residues), 37.3 bits, see alignment 4.5e-13 PF00989: PAS" amino acids 138 to 257 (120 residues), 55.8 bits, see alignment E=1.1e-18 PF08448: PAS_4" amino acids 144 to 207 (64 residues), 30.1 bits, see alignment E=1.3e-10 PF13426: PAS_9" amino acids 148 to 259 (112 residues), 51.7 bits, see alignment E=2.3e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 267 to 429 (163 residues), 136.5 bits, see alignment E=7.4e-44 PF00990: GGDEF" amino acids 271 to 426 (156 residues), 130.8 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 57% identity to bgf:BC1003_2139)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>H281DRAFT_02645 PAS domain S-box-containing protein/diguanylate cyclase (GGDEF) domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MVMSALPSTSHKFIDGMTIGIAVVTRDSRGEPVVSACNDVFLAMMDDARTHPRSFPVPLE
TSMLDKAGCGLREKLDACFDSGKAQGPEPACVSLDGARTWRVALEPMVGAHTPTVCMTVI
GQAPARQVSRELEASASRFQAVIDSAYDAIVTIDEEHRIRLFNRAAENLFGYRADEVIGQ
RIEMLLPEKFRGNHARNVRQFANSAQKSLRAVTPPRMDESNSVYGRHRDGTIIPVEIAIS
KIELEGEVEFTAVVRDISDRARLIQLLKKQAVTDALTGLPNRREFIDSVEKMLAADGVLS
VFILDIDYFKKINDSYGHDIGDEVLRVLADVGMTIPFESKLFARWGGEEFVGALPGADAS
VAFRIADALRKRCEQQESEHVWRTKPIAFTVSIGVVTREAGERDVDALMRRADRALYRAK
ETGRNRVAVG