Protein Info for H281DRAFT_02619 in Paraburkholderia bryophila 376MFSha3.1

Annotation: N-acyl-D-amino-acid deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF07969: Amidohydro_3" amino acids 46 to 458 (413 residues), 133.1 bits, see alignment E=2.2e-42 PF01979: Amidohydro_1" amino acids 390 to 457 (68 residues), 26.3 bits, see alignment E=4.3e-10

Best Hits

Swiss-Prot: 55% identical to NDDD_ALCXX: N-acyl-D-aspartate deacylase from Alcaligenes xylosoxydans xylosoxydans

KEGG orthology group: K06015, N-acyl-D-amino-acid deacylase [EC: 3.5.1.81] (inferred from 74% identity to bmu:Bmul_6029)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.81

Use Curated BLAST to search for 3.5.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>H281DRAFT_02619 N-acyl-D-amino-acid deacylase (Paraburkholderia bryophila 376MFSha3.1)
VHFQLIIRNGDVIDGTGDARFAADVGVNDDRIAAIGDLSAASADTTIDAAGKIVAPGFID
SHTHDDAFVLTNPDVTPKVVQGVTTVIAGNCGISLAPLSADAVPQPLDLLGAPECFAYDS
FGAYLAALERAPAAVNIAALVGHSTLRVRHMSDLAREATADERRRMAADVEEAMQAGAFG
VSSGTFYPPAASASTQELIDVCEPLRRHPGVFATHLRDETADIVPSMQEAFAIGGAVGAN
LVLSHHKVAGKENHGRSTETLALIDAQSERQPLCLDCHPYHATSTMLRADRIRQSSRVIL
AWSTKRPELAGKDFADVLPLYDGSIEAAIEDLKPAGAIYFVMDEGDVRRIFSHERTMVGS
DGLPNDTAPHPRLWGTFPRVLGHYSRDLKLFPLETAVRKMTGLTAEQFGIAGRGHVAEGS
YADLVVFDPDEVIDRATFDEPKLAPKGIEHVIVNGVPVLMHAQPTGARPGRPLRRSRP