Protein Info for H281DRAFT_02610 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methyl-accepting chemotaxis sensory transducer with Cache sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details PF08269: dCache_2" amino acids 32 to 177 (146 residues), 36.9 bits, see alignment E=3.8e-13 PF17200: sCache_2" amino acids 33 to 184 (152 residues), 97.9 bits, see alignment E=8.3e-32 PF00015: MCPsignal" amino acids 321 to 478 (158 residues), 180.5 bits, see alignment E=3.9e-57

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 75% identity to bph:Bphy_5545)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>H281DRAFT_02610 methyl-accepting chemotaxis sensory transducer with Cache sensor (Paraburkholderia bryophila 376MFSha3.1)
MKVSTKLISLVGAALAGVICIGAIALTQLDRALIEGRRAQITEMLNKAEHLALHYQSLEA
SGKLSRTDAQAAAKTAIAQLNANASSYYWITSTDSINLVHPNAALIGTKTGGNRTLEGDL
TDTQAYAKGLQERHIALVDVLIKRAQDAPLVPKLQGVVAIPQWQWWIGTGFFYDDINAVF
WRLARTLIAIGIVIFAVVATMAWFMTRSIRRTLGGEPADASEFAAQIASGNLAAQIALAP
GDRSSMLYALNEMRVKLRDLVRDIQNASETIASGSGEIAQGNTDLSQRTEEQAASLQETA
ASMEQLTATVKQNADNAGQASELAVLASDATARGGAAVDQVIGTMQEIADESHKIGQIIS
VIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVRSLAQRSATAAKDIKALIGSSVA
RVEGGTAQVATAGERMRDIVQSIKRVSDIMAEIAAASVEQSTGIEQVNRAVSQMDEVTQQ
NAALVEQATAAAASLDEQAARLRATVRVFRLAPNHALG