Protein Info for H281DRAFT_02606 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF05401: NodS" amino acids 55 to 159 (105 residues), 51 bits, see alignment E=8.5e-17 PF01135: PCMT" amino acids 76 to 147 (72 residues), 20.4 bits, see alignment E=2e-07 PF05175: MTS" amino acids 77 to 149 (73 residues), 29.4 bits, see alignment E=3e-10 PF13489: Methyltransf_23" amino acids 78 to 189 (112 residues), 75.5 bits, see alignment E=2.1e-24 PF07021: MetW" amino acids 79 to 164 (86 residues), 36.9 bits, see alignment E=1.5e-12 PF06325: PrmA" amino acids 79 to 178 (100 residues), 31.1 bits, see alignment E=9e-11 PF13847: Methyltransf_31" amino acids 80 to 182 (103 residues), 71.9 bits, see alignment E=2.5e-23 PF13649: Methyltransf_25" amino acids 84 to 173 (90 residues), 64.6 bits, see alignment E=5.5e-21 PF08241: Methyltransf_11" amino acids 85 to 177 (93 residues), 68.2 bits, see alignment E=4.2e-22 PF08242: Methyltransf_12" amino acids 85 to 175 (91 residues), 66.8 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 73% identity to bug:BC1001_0552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>H281DRAFT_02606 2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase (Paraburkholderia bryophila 376MFSha3.1)
LFDSNGIVSTARRLKKIMEWPIHKFMPVAINAWIMQPNNASISNTTWNDEYDSGAWDYLS
STKEVGRYSVIVGYCLHFKPAARILDVGCGTGILARWLSNAAISSYLGIDLSEAAIEKAR
QANIQRAEFAVADVTTFQTSQLFDVIIFNEVLYYLRNPDDYLGRFARYLAPGGILVVSMW
HHADGINTWKRLRAGFEELDRVRIVHVQSGLRWNVAVLIPR