Protein Info for H281DRAFT_02538 in Paraburkholderia bryophila 376MFSha3.1

Annotation: fatty-acyl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00501: AMP-binding" amino acids 19 to 401 (383 residues), 236.5 bits, see alignment E=4.5e-74 PF13193: AMP-binding_C" amino acids 452 to 526 (75 residues), 74.7 bits, see alignment E=9e-25

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 50% identity to lch:Lcho_2171)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>H281DRAFT_02538 fatty-acyl-CoA synthase (Paraburkholderia bryophila 376MFSha3.1)
MRSTMMDQPLLISSIIRHAAACHGSTEIVSRVSDGSLHRTSYAEVYERSSKLADALASWS
LQRGDRVGTLGWNDHRHLEIYYGVSGAGFVCHTINPRLFPDQIVYIVNHAGDRLLFVDPS
FVGLVAGVRQRLQSVERVIVMCSASAMPPEAIAEGFECYEEVIAAHKSGFDWPRLDENDA
AGLCYTSGTTGDPKGVLYSHRSTVLHALAVCAPDVFNLGERTTVMPVVPMFHVNGWGLPH
AAPMVGARLVLPGQKLDAANLYWLITTEKVTFTAGVPTVWGSLLDWIDDNKGEIAPLERV
AIGGAACPQIMAERFHEQGVDVVHAWGMTETSPVGLANRCTVPASPAREGIMSSNRRLKQ
GKPLFGVETRLLNNDDSVLPHDGTTSGRLQVRGPWVASSYFNLPLDSADRANDGWFETGD
IATIEAAGTVEIVDRAKDVIKSGGEWISSVTLENAAMSHPDVYEAAAVARDDERWGERPV
LFVVLRPGTAPSKEGLLSHLGTRVARWWVPDDIHFVDDLPHTATGKVVKATLRMRLRQ