Protein Info for H281DRAFT_02528 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 55% identical to UGL_BURCH: Ureidoglycolate lyase (Bcen2424_5521) from Burkholderia cenocepacia (strain HI2424)

KEGG orthology group: None (inferred from 64% identity to mno:Mnod_6025)

MetaCyc: 57% identical to 5-hydroxy-2,4-dioxopentanoate hydrolase (Herbaspirillum huttiense)
RXN-12096 [EC: 3.7.1.26]; 3.7.1.26 [EC: 3.7.1.26]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

L-rhamnose degradation III (6/7 steps found)
L-arabinose degradation V (5/6 steps found)
D-arabinose degradation IV (4/6 steps found)
D-xylose degradation VI (3/5 steps found)
L-fucose degradation III (5/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJT6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>H281DRAFT_02528 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) (Paraburkholderia bryophila 376MFSha3.1)
MKLFRFGPVGAEKPGVVDRNGTHRDLSAVIADIDPATIAAGLESRLANLDLTTLPEVPKG
TRFGPCIAQPGNFLAIGLNYVEHAKETNAPLPEEPILFNKAPSCIVGPDDDIVLPRGSEK
TDWEVELAFVIGKRAHYVSEADALSYVFGYCVCNDVSERAFQLERGGQWVKGKCAPSFGP
IGPYLVTAEEIPDPQKLPLWLEVNGERVQNSDTSDMIFSIRTIVSYVSQFVVLMPGDLIT
TGTPPGVGLGMKPERYLKRGDTVRLSVEGLGTQTQRVV