Protein Info for H281DRAFT_02499 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Acyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 19 to 481 (463 residues), 563 bits, E=2.2e-173

Best Hits

Swiss-Prot: 40% identical to ALDH4_BACSU: Putative aldehyde dehydrogenase DhaS (dhaS) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to bpy:Bphyt_5173)

MetaCyc: 44% identical to maleylacetate reductase (Pseudomonas sp. ENV2030)
Maleylacetate reductase. [EC: 1.3.1.32]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• putrescine degradation V (2/2 steps found)
• 4-chlorocatechol degradation (4/5 steps found)
• octane oxidation (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• 4-sulfocatechol degradation (3/4 steps found)
• phytol degradation (3/4 steps found)
• 2,4,6-trichlorophenol degradation (5/7 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• resorcinol degradation (2/3 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• 3-chlorocatechol degradation II (ortho) (3/5 steps found)
• 4-nitrophenol degradation II (3/5 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• 3,5-dichlorocatechol degradation (5/8 steps found)
• superpathway of ornithine degradation (5/8 steps found)
• γ-resorcylate degradation I (2/4 steps found)
• γ-resorcylate degradation II (2/4 steps found)
• 4-aminophenol degradation (2/4 steps found)
• D-arabinose degradation II (2/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
• 4,5-dichlorocatechol degradation (4/7 steps found)
• chlorosalicylate degradation (4/7 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• 1,4-dichlorobenzene degradation (5/9 steps found)
• 2,4,5-trichlorophenoxyacetate degradation (5/9 steps found)
• 3,4,6-trichlorocatechol degradation (5/9 steps found)
• 3-chlorocatechol degradation I (ortho) (2/5 steps found)
• 4-hydroxyacetophenone degradation (2/5 steps found)
• γ-hexachlorocyclohexane degradation (6/11 steps found)
• serotonin degradation (3/7 steps found)
• pentachlorophenol degradation (5/10 steps found)
• 4-nitrophenol degradation I (1/5 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• pinoresinol degradation (2/10 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of pentose and pentitol degradation (21/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 1,4-Dichlorobenzene degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.3.1.32

Sequence Analysis Tools

See A0A2Z5MHX1 at UniProt or InterPro

Protein Sequence (503 amino acids)

>H281DRAFT_02499 Acyl-CoA reductase (Paraburkholderia bryophila 376MFSha3.1)
MNTGNSQRYDAQLLIGGEWTDAEDGRTLDIVNPATGEVIGALASASARDVDRAVQAGHRA
FEGGAWRDMSIQQRARILNRFADLFEADLEQFYKLETLNNGRPIAETRAQISRLPQFYRY
FAALALTRRSDVIPIEGPYLCYTQRVPLGVVALMTSFNHPLMILSKSLAPALATGNSVVI
KASEQTPLTTVRLVKLLQDAGVPKGVVNVVNGEGRVAGAALAQHPLIRKVVFTGGTEVGR
SIGEAAARNFALTTLELGGKGAVILFDDFDIERAVNGASFAAFIGAGQTCVCGARILVQK
SMYAAFLERFRAKVERIRVGDPTDAKTQLGPVISERSRQRILAMLERAQQAGAKLLTGGR
VPQELTSGYFLEPTVVYDADPHSEIGQDEVFGPVTVVMPFEDEADAIRIANDTSFGLAAS
IWTQDVARAHRVAGRLEFGMVWVNDHHRLDPASPWGGFKNSGVGRETGIESFDQFSEPRA
VTINTSGKTVDWYADDGELKRLN