Protein Info for H281DRAFT_02461 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MFS transporter, putative metabolite:H+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 60 to 83 (24 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 216 to 233 (18 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details PF07690: MFS_1" amino acids 64 to 375 (312 residues), 151.9 bits, see alignment E=2.3e-48 amino acids 339 to 477 (139 residues), 36.9 bits, see alignment E=2.2e-13 PF00083: Sugar_tr" amino acids 82 to 486 (405 residues), 161.7 bits, see alignment E=2.9e-51

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 96% identity to bgf:BC1003_5869)

Predicted SEED Role

"Niacin transporter NiaP" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHC9 at UniProt or InterPro

Protein Sequence (505 amino acids)

>H281DRAFT_02461 MFS transporter, putative metabolite:H+ symporter (Paraburkholderia bryophila 376MFSha3.1)
MTYFFYVADLCRRLLNVLIGTSLAAAPQYSGDAMPTASQSRASAAARLERLPFSGYHRTI
FIIIAIAFFFDSVDLGTMTFVLGSIKTEFGLSTATAGLVASASFFGMVGGAAVAGLLADR
FGRRPVFQWSMVLWGLASYLCSTAQSVEALIFYRVLLGFGMGMEFPIAQTLLSEFVPASS
RGRLIALMDGFWPLGFITAGVVSYFVLPTFGWRTEFALLAIPAVFVLVVRRIVPESPRWL
EHRGRLGDADKILADIEVKVMKSAGLSHLRPPVMLAEPVATKGAGAFREIWSAAYRRRTV
MVWTLWFFALLGFYGLTSWLGALMQQAGFAVTKSVLYTVLISLGGIPGFICAAWLVERWG
RKPTCIASLAGSAVMAYVYGQTALHAQTPTLLICAGLAMQFFLFAMWAVLYTYTPELYGT
GARATGSGFASAIGRVGSLIGPYVVGVVLPVFGQGGVFSLGAMCFVIAAAAVWILGIETR
GLALETLVSEAVESDAHGVLSPARE