Protein Info for H281DRAFT_02451 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glycine betaine/proline transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details TIGR03416: choline ABC transporter, permease protein" amino acids 3 to 267 (265 residues), 384.2 bits, see alignment E=1.8e-119 PF00528: BPD_transp_1" amino acids 106 to 263 (158 residues), 100.1 bits, see alignment E=6.5e-33

Best Hits

Swiss-Prot: 50% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 95% identity to bug:BC1001_5820)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJN6 at UniProt or InterPro

Protein Sequence (300 amino acids)

>H281DRAFT_02451 glycine betaine/proline transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSEVIPLGTWVDHGVHYLLDHDAKTFDSIGKVIEGFAALIEQGLQAVPMWALMAFFVGIG
LWRVGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTLISLLLGVPLGIWTAKSRTVE
MIVRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREI
VEAGQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLAS
IQRLDIGLGFESGLSVVMLAIILDRITESFGRSPGMARAPLLSGLRSVMKVRRAPAAQHS