Protein Info for H281DRAFT_02402 in Paraburkholderia bryophila 376MFSha3.1

Annotation: replication restart DNA helicase PriA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF17764: PriA_3primeBD" amino acids 7 to 102 (96 residues), 77.2 bits, see alignment E=2.2e-25 PF04851: ResIII" amino acids 206 to 372 (167 residues), 47.7 bits, see alignment E=5.1e-16 PF00270: DEAD" amino acids 209 to 373 (165 residues), 62.1 bits, see alignment E=1.7e-20 TIGR00595: primosomal protein N'" amino acids 228 to 746 (519 residues), 552.9 bits, see alignment E=3.3e-170 PF18319: Zn_ribbon_PriA" amino acids 464 to 490 (27 residues), 37.9 bits, see alignment (E = 4.1e-13) PF00271: Helicase_C" amino acids 512 to 608 (97 residues), 32.4 bits, see alignment E=2.8e-11 PF18074: PriA_C" amino acids 651 to 745 (95 residues), 55.4 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 92% identity to bpy:Bphyt_3889)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFJ2 at UniProt or InterPro

Protein Sequence (748 amino acids)

>H281DRAFT_02402 replication restart DNA helicase PriA (Paraburkholderia bryophila 376MFSha3.1)
MSEAFVRVALDHPLPTLFDYRCDSSQSPVPGTLVSVPFGKRDVVGLVCEVTGHSEVPADR
LRSVNGVCTGCPPLSAEWLALAAFAADYYQRGLGEVALPALPQALRDASRWSRLLAPEER
YRLTPEGRAALPDALPARATALRNLAQALAAGEFLSAADARGLHPKAISTLAAWQAEGWV
ALDVVDAATAPPAAAATPAPSQPLPTLTDEQAAAVEAIRDAHGFAPFLLHGVTGSGKTEV
YLRALAEILAANADAQALVLVPEINLTPQFEAAFRARFAALADTAIVTLHSGLAEGERAR
NWFAAHAGHARIVLGTRLAVLASLPRLAIIVVDEEHDPAYKQQEGLRYSARDLAIYRAKQ
LGLPVVLGSATPSLESWWQADQGRYKRLTLSRRAVADAVLPTVRLIDLEDERRRGRASVE
GLSGPLIAALKTRLERGEQSLVFLNRRGYAPQLACDACGWVAGCPRCSAYVVLHKPERAL
RCHHCGWESRIPRSCPECGNVDIAPMGRGTQRVEETLASAVPGARVLRIDADSTRRKGSA
QALFSDVHAGEVDILVGTQMIAKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQV
SGRAGRAGLPGEVLVQTRYPRHALYHALGRHDYVGFANSTLAERRDAHLPPFVYQALLRA
EGRTLEAALAFLQQGAAELTGIAAAERVTVYDAVPLTIVKVMHVHRAQLLIESASRAALQ
ATLRAWQPLLRGLKGVLRWNLEVDPLDI