Protein Info for H281DRAFT_02379 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid/amide ABC transporter membrane protein 2, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 59 (27 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 235 to 263 (29 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 27 to 300 (274 residues), 107.8 bits, see alignment E=2.8e-35

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 95% identity to bxe:Bxe_A0021)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGG5 at UniProt or InterPro

Protein Sequence (323 amino acids)

>H281DRAFT_02379 amino acid/amide ABC transporter membrane protein 2, HAAT family (Paraburkholderia bryophila 376MFSha3.1)
MQRKVLYGLLLVVLLAVPVLGIYPLFVMKVMCFALFAAAFNLLIGYTGLLSFGHAMFLAS
AGYITGYAMQTLGFSPELGVLAGTASATLLGFIVGIFAIRRQGIYFAMVTLALAQMVYFV
FLQAPFTHGEDGLQGVPRGKLFGVLNLSSDVTLYFVVLAVIVLAFLLIVRIVHSPFGQVL
VAIKENEPRAVSLGYDTDRFKLLAFILSAGLAGLAGSLKVVVQGFETLSDAYWTMSGLVV
LMTLVGGMGTLFGPLLGAALIVALEDRLGDIGGALASTTGIEWFRSLGESVTIVTGVIFI
ACVLAFRRGIVGEIIARVRPLRA