Protein Info for H281DRAFT_02364 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GMP synthase (glutamine-hydrolysing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 45 to 189 (145 residues), 62.6 bits, E=4.2e-21
• PF07722: Peptidase_C26
  • amino acids 73 to 106 (34 residues), 20.6 bits, 3.2e-08

Best Hits

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 95% identity to bug:BC1001_3553)

Predicted SEED Role

"GMP synthase - Glutamine amidotransferase domain"

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A2Z5MGT2 at UniProt or InterPro

Protein Sequence (237 amino acids)

>H281DRAFT_02364 GMP synthase (glutamine-hydrolysing) (Paraburkholderia bryophila 376MFSha3.1)
MNQEVLAIRHVYFEDLGSLELVLGERGRPVRYLDVGFARIEAPNPVSPSLMVVLGGPISA
TDDALYPSLVPLLSMIEKRIEAGLPTLGICLGAQLIARALGARVYPAGHVELGWEPLTLT
DAGRASPVRHLDGAQTSMLHWHGDTFDLPANATRLASTSACENQAFAWGDHVLALQCHPE
IRADRFEPWLIGNAGELVGHGIDARQLRAETAQFGPALEAAACRMFGEWLDQVERKP