Protein Info for H281DRAFT_02361 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transporter, CPA2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 232 to 262 (31 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 381 (363 residues), 108.2 bits, see alignment E=2.1e-35

Best Hits

KEGG orthology group: None (inferred from 99% identity to bug:BC1001_3556)

Predicted SEED Role

"Transporter, monovalent cation:proton antiporter-2 (CPA2) family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEY3 at UniProt or InterPro

Protein Sequence (401 amino acids)

>H281DRAFT_02361 transporter, CPA2 family (Paraburkholderia bryophila 376MFSha3.1)
MNSAFSFFPAWPLAPDAIFWAGLALLAAGLCGELCYRAWRLPRISGYAVIGLIAGAAGSG
VIDAESAKAARPLLDVALGLLLFELGSRLDLRWIRRNPWLVMSSVAEATLTFALVLPVLL
FLNVPLMVATVLAAIAMATSPAMVIQLKTELRAEGQVTQRLLTLTALNSMYAVVIEKLVS
SWLHQEAYGNVFATILQPLYLLAGSLVLAYLLARTCTFFYRRMNMQDEHSFVALFGLVLL
AIAVAHLFKLSTILALLAAGIIVKNLEARPQLWPQHFGTAGWLLTVILFVLTLTSFEWKD
IALGGVAALGLIVARLVAKLVGVLAFAKPSGLNWKQGMALGLSLSPMSALAYLLVDDTYN
LYPNFDPQLRAIVMCSIVVLQILGPWLVYRSLALVAERREE