Protein Info for H281DRAFT_02356 in Paraburkholderia bryophila 376MFSha3.1

Annotation: general secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 27 to 96 (70 residues), 90.3 bits, see alignment E=8.8e-30 TIGR02517: type II secretion system protein D" amino acids 27 to 679 (653 residues), 678.1 bits, see alignment E=5.6e-208 PF03958: Secretin_N" amino acids 124 to 185 (62 residues), 52.3 bits, see alignment 8.1e-18 amino acids 187 to 257 (71 residues), 49.5 bits, see alignment E=6e-17 amino acids 264 to 408 (145 residues), 55.7 bits, see alignment E=7e-19 PF00263: Secretin" amino acids 500 to 669 (170 residues), 167.1 bits, see alignment E=4.2e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 93% identity to bug:BC1001_3561)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (783 amino acids)

>H281DRAFT_02356 general secretion pathway protein D (Paraburkholderia bryophila 376MFSha3.1)
MALRRVATALLVAGLITAQTADAQVTLNFVNADIDQVAKAIGAATGKTIIVDPRVKGQLN
LVSENAVPEDQALKTLQSALRMQGFALVQDHGVLKVVPEADAKLQGVPTYVGNAPTARGD
QVVTQVFVLKNESANNLLPVLRPLISPNNTVAAYPANNTIVVTDYADNVRRIAQIIAGVD
TAAGQSVSVVQLKNANALDIAAQLNKMLDPGAIGSTDATLKVSITADPRTNSLLIRASNG
ARLAAARTLARELDAPTSMPGNMHVVPLRNAEATKLAKTLRGMLGKGGESGSSGGTNEAN
AFNQNTGGGLGGNNSTGTSGTPPLPSGGLNSSSMSSPMGGSGAGGYGSNSGNAAGGLLGG
DKDKNDDNQPGGMIQADAATNSLIITASEPVYRNLRTVIDQLDARRAQVYIEALIVELNS
NTSGNLGIQWQVANNSLFAGTNLATGSSNSIINLTAGAAAAGATGGLATALATQGVQQGL
NIGWLHNIFGVQGLGALLQALSQTADANVLSTPNLITLDNEEAKIVVGTNIPIQTGSYSN
LTSGSASSAFNTYDRVDVGLTLHVKPQITDGGILKLQLYTEDSAIVNGTTNATTNPAGPQ
FTKRSIQSTVLADNGEIIVLGGLMQDNYQVSNSKVPLLGDIPWIGQLFRSEQKNRNKTNL
MVFLRPVIISDRDTAQAVTSNRYDYIQGVQGAYRQDNNLMKDKDDPVVPPMPVGPSQGGS
PLNLFDLDQMRRQQMQPPQPRSSAPQPNNGTPYTAPAAPAVNGAVQSNPVPVAPSTASPG
VQP